PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1938_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family HB-other
Protein Properties Length: 489aa    MW: 54568.9 Da    PI: 6.6894
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1938_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.5e-182176257
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
    Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                +kR   t+ q+ +Le+++++++yps+e+++++A+++gLte+qV+ WF+ rR k+k+
  RrC1938_p3 21 KKRKLKTPIQVMALENFYNEHKYPSEEMKAKMAEEIGLTEKQVSGWFCHRRLKDKR 76
                8999**************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-19576IPR009057Homeodomain-like
PROSITE profilePS5007116.5841777IPR001356Homeobox domain
SuperFamilySSF466896.84E-171983IPR009057Homeodomain-like
SMARTSM003898.1E-191981IPR001356Homeobox domain
CDDcd000861.60E-172177No hitNo description
PfamPF000461.1E-152176IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MLSDSGEMPA DGDKHSAENS KKRKLKTPIQ VMALENFYNE HKYPSEEMKA KMAEEIGLTE  60
KQVSGWFCHR RLKDKRSVKE DGNNIGGSQD RSSVVLQDRG SVLRQDSCGS TKQTDYWNAK  120
PREVESQRLY DDDGEEDSTS SERRSSLHKS LVSSKDVESS RYVARSEHPQ VMRGYGFSKP  180
SGYLKVKGDN ENVAITAVKR QLGRQYREDG PPLGVVFDPL PPGAFEPQTN VIVQEPIYVG  240
SQRRSHPPYF TGTRKSFVPG PSYELARKSK MHSSEDEDED DDEDEDDMMG GMEPGLGDKQ  300
SLREPSFKSP SLSYSNAAVP DRKGPPQGVP STNNKKSHIS SKGRAEGSRN NMIADFHNLS  360
GTNQTHDYDK STFNGGRQTG YLAKSSNMLP LSSSRSSDSM ERDPSSGMVG KYHGEKMNHR  420
EMHREKLHST GEPLVTKGLK HGYPQQLYTP KPSNSETFER KDQINRSGVE LPSSFNGDET  480
EESSSSSMD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1225430.0AC122543.1 Genomic sequence for Brassica oleracea, clone B21H13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608630.10.0PREDICTED: uncharacterized protein LOC106315448
TrEMBLA0A0D3E0890.0A0A0D3E089_BRAOL; Uncharacterized protein
STRINGBra034196.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122022531
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.10.0HB-other family protein